
Indexat a
Llicència i ús

Grant support
This research was funded by projects APOGEO (Cooperation Program INTERREG-MAC 2014-2020, with European Funds for Regional Development-FEDER, "Agencia Canaria de Investigacion, Innovacion y Sociedad de la Informacion (ACIISI) del Gobierno de Canarias", Project ProID2020010134 "Bioprospeccion y biotecnologia en el descubrimiento de peptidos antimicrobianos contra patogenos resistentes" and Caja Canarias, Project 2019SP43.
Anàlisi d'autories institucional
Baca-Gonzalez, VAutor o coautorAntimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis
Publicat a:Vaccines. 10 (7): - 2022-07-01 10(7), DOI: 10.3390/vaccines10071105
Autors: Otazo-Perez, A; Asensio-Calavia, P; Gonzalez-Acosta, S; Baca-Gonzalez, V; Lopez, MR; Morales-delaNuez, A; de la Lastra, JMP
Afiliacions
Resum
The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development.
Paraules clau
Indicis de qualitat
Impacte bibliomètric. Anàlisi de la contribució i canal de difusió
El treball ha estat publicat a la revista Vaccines a causa de la seva progressió i el bon impacte que ha aconseguit en els últims anys, segons l'agència WoS (JCR), s'ha convertit en una referència en el seu camp. A l'any de publicació del treball, 2022, es trobava a la posició 24/136, aconseguint així situar-se com a revista Q1 (Primer Cuartil), en la categoria Medicine, Research & Experimental.
Des d'una perspectiva relativa, i atenent a l'indicador de impacte normalitzat calculat a partir del Field Citation Ratio (FCR) de la font Dimensions, proporciona un valor de: 2.31, el que indica que, comparat amb treballs en la mateixa disciplina i en el mateix any de publicació, el situa com un treball citat per sobre de la mitjana. (font consultada: Dimensions Aug 2025)
Concretament, i atenent a les diferents agències d'indexació, aquest treball ha acumulat, fins a la data 2025-08-12, el següent nombre de cites:
- WoS: 2
- Scopus: 2